PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.002G209300.1.p
Common NameSb02g025350, SORBIDRAFT_02g025350
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 370aa    MW: 39857.4 Da    PI: 7.1615
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.002G209300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.41.6e-131462148
                          TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                          +g+W +eEd  l+ ++ ++G g +W   ++++g++R++k+c++rw++yl
  Sobic.002G209300.1.p 14 KGPWAPEEDAVLKAYIDEHGAGgNWIQLPHKIGLNRCGKSCRLRWLNYL 62
                          79*********************************************97 PP

2Myb_DNA-binding43.95.3e-1469111246
                           SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
       Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                           g +T+eEd l+  +    G++ W+tIa+ ++ gRt++++k++w++
  Sobic.002G209300.1.p  69 GGFTEEEDRLICSLYISIGSR-WATIAAQLP-GRTDNDVKNHWNT 111
                           569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.935962IPR017930Myb domain
SuperFamilySSF466898.39E-2612109IPR009057Homeodomain-like
SMARTSM007176.4E-101364IPR001005SANT/Myb domain
PfamPF002494.8E-121462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.9E-231569IPR009057Homeodomain-like
CDDcd001672.44E-71662No hitNo description
PROSITE profilePS5129422.30163117IPR017930Myb domain
SMARTSM007176.1E-1267115IPR001005SANT/Myb domain
PfamPF002495.2E-1269111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.9E-2270117IPR009057Homeodomain-like
CDDcd001673.53E-971113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MGRAPCCNKA TVKKGPWAPE EDAVLKAYID EHGAGGNWIQ LPHKIGLNRC GKSCRLRWLN  60
YLRPNIRHGG FTEEEDRLIC SLYISIGSRW ATIAAQLPGR TDNDVKNHWN TKLKRRLLGG  120
GRRPRAEARL QLLTNPTTWQ HHNSFASSAL ERMKVSMRLH RRHQDQARLD NPAAAAAAFT  180
LYNYGSSLGA PLWPSLSSSS SPSPAASESS EMLPRQPPGA GATSTGYSGG LWTHMPGSFG  240
YTGAGVQENI DGTCTPPLST STGETMTAVG VESSSSTPTA SSASATFGSS MDDEIDMLLR  300
QIQCFGENNG HHIGDEVVTV DGIDHCFRAI MDHHEMANGN GSVGSWSSCC STPGVDSVFD  360
DYVQGYNQC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-25141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0632600.0BT063260.1 Zea mays full-length cDNA clone ZM_BFc0043P16 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002462421.10.0hypothetical protein SORBIDRAFT_02g025350
SwissprotQ9FKL25e-74MYB36_ARATH; Transcription factor MYB36
TrEMBLC5XD130.0C5XD13_SORBI; Putative uncharacterized protein Sb02g025350
STRINGSb02g025350.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132652632
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.13e-67myb domain protein 36